Lineage for d1ahjg_ (1ahj G:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36544Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
  4. 36545Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family) (S)
  5. 36546Family d.149.1.1: Nitrile hydratase alpha chain [56210] (1 protein)
  6. 36547Protein Nitrile hydratase alpha chain [56211] (1 species)
  7. 36548Species Rhodococcus erythropolis [56212] (2 PDB entries)
  8. 36554Domain d1ahjg_: 1ahj G: [41777]
    Other proteins in same PDB: d1ahjb_, d1ahjd_, d1ahjf_, d1ahjh_

Details for d1ahjg_

PDB Entry: 1ahj (more details), 2.65 Å

PDB Description: nitrile hydratase

SCOP Domain Sequences for d1ahjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahjg_ d.149.1.1 (G:) Nitrile hydratase alpha chain {Rhodococcus erythropolis}
enaapaqaavsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvptv

SCOP Domain Coordinates for d1ahjg_:

Click to download the PDB-style file with coordinates for d1ahjg_.
(The format of our PDB-style files is described here.)

Timeline for d1ahjg_: