![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily) 4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets |
![]() | Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins) automatically mapped to Pfam PF02979 |
![]() | Protein Iron-containing nitrile hydratase [56211] (1 species) |
![]() | Species Rhodococcus erythropolis [TaxId:1833] [56212] (3 PDB entries) also Rhodococcus sp. R312 |
![]() | Domain d1ahje_: 1ahj E: [41776] Other proteins in same PDB: d1ahjb_, d1ahjd_, d1ahjf_, d1ahjh_ complexed with fe |
PDB Entry: 1ahj (more details), 2.65 Å
SCOPe Domain Sequences for d1ahje_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahje_ d.149.1.1 (E:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]} enaapaqaavsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe ivtkdcligvaipqvptv
Timeline for d1ahje_: