Lineage for d1ahjc_ (1ahj C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735651Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 735652Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family) (S)
    duplication: contains two structural repeats
  5. 735653Family d.149.1.1: Nitrile hydratase alpha chain [56210] (2 proteins)
  6. 735663Protein Iron-containing nitrile hydratase [56211] (1 species)
  7. 735664Species Rhodococcus erythropolis [TaxId:1833] [56212] (7 PDB entries)
    also Rhodococcus sp. R312
  8. 735673Domain d1ahjc_: 1ahj C: [41775]
    Other proteins in same PDB: d1ahjb_, d1ahjd_, d1ahjf_, d1ahjh_

Details for d1ahjc_

PDB Entry: 1ahj (more details), 2.65 Å

PDB Description: nitrile hydratase
PDB Compounds: (C:) nitrile hydratase (subunit alpha)

SCOP Domain Sequences for d1ahjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahjc_ d.149.1.1 (C:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqaavsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvptv

SCOP Domain Coordinates for d1ahjc_:

Click to download the PDB-style file with coordinates for d1ahjc_.
(The format of our PDB-style files is described here.)

Timeline for d1ahjc_: