Lineage for d1ahja_ (1ahj A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84715Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
  4. 84716Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family) (S)
  5. 84717Family d.149.1.1: Nitrile hydratase alpha chain [56210] (1 protein)
  6. 84718Protein Nitrile hydratase alpha chain [56211] (1 species)
  7. 84719Species Rhodococcus erythropolis [56212] (2 PDB entries)
  8. 84722Domain d1ahja_: 1ahj A: [41774]
    Other proteins in same PDB: d1ahjb_, d1ahjd_, d1ahjf_, d1ahjh_

Details for d1ahja_

PDB Entry: 1ahj (more details), 2.65 Å

PDB Description: nitrile hydratase

SCOP Domain Sequences for d1ahja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahja_ d.149.1.1 (A:) Nitrile hydratase alpha chain {Rhodococcus erythropolis}
enaapaqaavsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvptv

SCOP Domain Coordinates for d1ahja_:

Click to download the PDB-style file with coordinates for d1ahja_.
(The format of our PDB-style files is described here.)

Timeline for d1ahja_: