Lineage for d2ahja_ (2ahj A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548277Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2548278Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2548279Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2548290Protein Iron-containing nitrile hydratase [56211] (1 species)
  7. 2548291Species Rhodococcus erythropolis [TaxId:1833] [56212] (3 PDB entries)
    also Rhodococcus sp. R312
  8. 2548293Domain d2ahja_: 2ahj A: [41772]
    Other proteins in same PDB: d2ahjb_, d2ahjd_
    complexed with dio, fe, no, so4, zn

Details for d2ahja_

PDB Entry: 2ahj (more details), 1.7 Å

PDB Description: nitrile hydratase complexed with nitric oxide
PDB Compounds: (A:) nitrile hydratase

SCOPe Domain Sequences for d2ahja_:

Sequence, based on SEQRES records: (download)

>d2ahja_ d.149.1.1 (A:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
idhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvara
wtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglp
ptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsq
eqlqeivtkdcligvaipqv

Sequence, based on observed residues (ATOM records): (download)

>d2ahja_ d.149.1.1 (A:) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
idhpaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpef
rqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyks
feyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqei
vtkdcligvaipqv

SCOPe Domain Coordinates for d2ahja_:

Click to download the PDB-style file with coordinates for d2ahja_.
(The format of our PDB-style files is described here.)

Timeline for d2ahja_: