SCOPe 2.08: Domain d7c0za_: 7c0z A:

Lineage for d7c0za_ (7c0z A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [420023] (34 PDB entries)

8. Domain d7c0za_: 7c0z A: [417716]
   automated match to d7bvta_
   complexed with edo, fgo

Details for d7c0za_

PDB Entry: 7c0z, 2.2 Å

PDB Description: crystal structure of a dinucleotide-binding protein (y246a) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii)

PDB Compounds: (A:) Sugar ABC transporter, periplasmic sugar-binding protein

SCOPe Domain Sequences for d7c0za_:

Sequence; same for both SEQRES and ATOM records:

>d7c0za_ c.94.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
kpedvikeqcarakvvaelwhgftggapkaalenlvvefnkaqqgrcvrpvpqggyrdls
tkikaafaagkvptmaqafennialyleakallpieslgvklqgvnltflnavrfggvvy
gvpfnksiqvlyynkdllkkhgvpvpatleefvaaakklsraeggpvywfqpdastfayf
ffnlggsylkdgklvlnskeavealtllqngvkegwakpitsgyinqnlgsgpyafsvdt
sagytaylraakfdlgvatlpgrtkgqpgyglvqgtnlvvfrqaskeeqavakdflefvl
spraqavfatatgyvpvtegalkdpvyqayaaenpdyativrqsryakfepalaeweqir
fdilgqaikeailnkadpkaaldraqklaedll

Timeline for d7c0za_:

• d7c0za_ is new in SCOPe 2.08-stable