Lineage for d1d5fc_ (1d5f C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594050Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. 2594051Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) (S)
    automatically mapped to Pfam PF00632
  5. 2594052Family d.148.1.1: Hect, E3 ligase catalytic domain [56205] (3 proteins)
  6. 2594053Protein Ubiquitin-protein ligase E3a (E6ap) [56206] (1 species)
  7. 2594054Species Human (Homo sapiens) [TaxId:9606] [56207] (2 PDB entries)
  8. 2594060Domain d1d5fc_: 1d5f C: [41771]

Details for d1d5fc_

PDB Entry: 1d5f (more details), 2.8 Å

PDB Description: structure of e6ap: insights into ubiquitination pathway
PDB Compounds: (C:) e6ap hect catalytic domain, e3 ligase

SCOPe Domain Sequences for d1d5fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5fc_ d.148.1.1 (C:) Ubiquitin-protein ligase E3a (E6ap) {Human (Homo sapiens) [TaxId: 9606]}
npylrlkvrrdhiiddalvrlemiamenpadlkkqlyvefegeqgvdeggvskeffqlvv
eeifnpdigmftydestklfwfnpssfetegqftligivlglaiynncildvhfpmvvyr
klmgkkgtfrdlgdshpvlyqslkdlleyegnveddmmitfqisqtdlfgnpmmydlken
gdkipitnenrkefvnlysdyilnksvekqfkafrrgfhmvtnesplkylfrpeeielli
cgsrnldfqaleetteydggytrdsvlirefweivhsftdeqkrlflqfttgtdrapvgg
lgklkmiiakngpdterlptshtcfnvlllpeysskeklkerllkaitya

SCOPe Domain Coordinates for d1d5fc_:

Click to download the PDB-style file with coordinates for d1d5fc_.
(The format of our PDB-style files is described here.)

Timeline for d1d5fc_: