SCOPe 2.08: Domain d7c0ob1: 7c0o B:1-396

Lineage for d7c0ob1 (7c0o B:1-396)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [420023] (34 PDB entries)

8. Domain d7c0ob1: 7c0o B:1-396 [417691]
   Other proteins in same PDB: d7c0oa2, d7c0ob2
   automated match to d7bvta_
   complexed with co2, co3, edo, fgo, gol, na, peg

Details for d7c0ob1

PDB Entry: 7c0o, 2 Å

PDB Description: crystal structure of a dinucleotide-binding protein (y56f) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine

PDB Compounds: (B:) Sugar ABC transporter, periplasmic sugar-binding protein

SCOPe Domain Sequences for d7c0ob1:

Sequence; same for both SEQRES and ATOM records:

>d7c0ob1 c.94.1.0 (B:1-396) automated matches {Thermus thermophilus [TaxId: 300852]}
kpedvikeqcarakvvaelwhgftggapkaalenlvvefnkaqqgrcvrpvpqggfrdls
tkikaafaagkvptmaqafennialyleakallpieslgvklqgvnltflnavrfggvvy
gvpfnksiqvlyynkdllkkhgvpvpatleefvaaakklsraeggpvywfqpdastfayf
ffnlggsylkdgklvlnskeavealtllqngvkegwakpitsgyinqnlgsgpyafsvdt
sagytyylraakfdlgvatlpgrtkgqpgyglvqgtnlvvfrqaskeeqavakdflefvl
spraqavfatatgyvpvtegalkdpvyqayaaenpdyativrqsryakfepalaeweqir
fdilgqaikeailnkadpkaaldraqklaedllssr

Timeline for d7c0ob1:

• d7c0ob1 is new in SCOPe 2.08-stable