SCOPe 2.08: Domain d1c4zc_: 1c4z C:

Lineage for d1c4zc_ (1c4z C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
   consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation

4. Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families)
   automatically mapped to Pfam PF00632

5. Family d.148.1.1: Hect, E3 ligase catalytic domain [56205] (3 proteins)

6. Protein Ubiquitin-protein ligase E3a (E6ap) [56206] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56207] (2 PDB entries)

8. Domain d1c4zc_: 1c4z C: [41768]
   Other proteins in same PDB: d1c4zd_

Details for d1c4zc_

PDB Entry: 1c4z, 2.6 Å

PDB Description: structure of an e6ap-ubch7 complex: insights into the ubiquitination pathway

PDB Compounds: (C:) ubiquitin-protein ligase e3a

SCOPe Domain Sequences for d1c4zc_:

Sequence; same for both SEQRES and ATOM records:

>d1c4zc_ d.148.1.1 (C:) Ubiquitin-protein ligase E3a (E6ap) {Human (Homo sapiens) [TaxId: 9606]}
npylrlkvrrdhiiddalvrlemiamenpadlkkqlyvefegeqgvdeggvskeffqlvv
eeifnpdigmftydestklfwfnpssfetegqftligivlglaiynncildvhfpmvvyr
klmgkkgtfrdlgdshpvlyqslkdlleyegnveddmmitfqisqtdlfgnpmmydlken
gdkipitnenrkefvnlysdyilnksvekqfkafrrgfhmvtnesplkylfrpeeielli
cgsrnldfqaleetteydggytrdsvlirefweivhsftdeqkrlflqfttgtdrapvgg
lgklkmiiakngpdterlptshtcfnvlllpeysskeklkerllkaitya

Timeline for d1c4zc_:

• d1c4zc_ first appeared (with stable ids) in SCOP 1.55
  
• d1c4zc_ appears in SCOPe 2.07