Lineage for d1c4za_ (1c4z A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1933981Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. 1933982Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) (S)
    automatically mapped to Pfam PF00632
  5. 1933983Family d.148.1.1: Hect, E3 ligase catalytic domain [56205] (3 proteins)
  6. 1933984Protein Ubiquitin-protein ligase E3a (E6ap) [56206] (1 species)
  7. 1933985Species Human (Homo sapiens) [TaxId:9606] [56207] (2 PDB entries)
  8. 1933986Domain d1c4za_: 1c4z A: [41766]
    Other proteins in same PDB: d1c4zd_

Details for d1c4za_

PDB Entry: 1c4z (more details), 2.6 Å

PDB Description: structure of an e6ap-ubch7 complex: insights into the ubiquitination pathway
PDB Compounds: (A:) ubiquitin-protein ligase e3a

SCOPe Domain Sequences for d1c4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4za_ d.148.1.1 (A:) Ubiquitin-protein ligase E3a (E6ap) {Human (Homo sapiens) [TaxId: 9606]}
npylrlkvrrdhiiddalvrlemiamenpadlkkqlyvefegeqgvdeggvskeffqlvv
eeifnpdigmftydestklfwfnpssfetegqftligivlglaiynncildvhfpmvvyr
klmgkkgtfrdlgdshpvlyqslkdlleyegnveddmmitfqisqtdlfgnpmmydlken
gdkipitnenrkefvnlysdyilnksvekqfkafrrgfhmvtnesplkylfrpeeielli
cgsrnldfqaleetteydggytrdsvlirefweivhsftdeqkrlflqfttgtdrapvgg
lgklkmiiakngpdterlptshtcfnvlllpeysskeklkerllkaitya

SCOPe Domain Coordinates for d1c4za_:

Click to download the PDB-style file with coordinates for d1c4za_.
(The format of our PDB-style files is described here.)

Timeline for d1c4za_: