Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily) consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation |
Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) automatically mapped to Pfam PF00632 |
Family d.148.1.1: Hect, E3 ligase catalytic domain [56205] (3 proteins) |
Protein Ubiquitin-protein ligase E3a (E6ap) [56206] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56207] (2 PDB entries) |
Domain d1c4za_: 1c4z A: [41766] Other proteins in same PDB: d1c4zd_ |
PDB Entry: 1c4z (more details), 2.6 Å
SCOPe Domain Sequences for d1c4za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c4za_ d.148.1.1 (A:) Ubiquitin-protein ligase E3a (E6ap) {Human (Homo sapiens) [TaxId: 9606]} npylrlkvrrdhiiddalvrlemiamenpadlkkqlyvefegeqgvdeggvskeffqlvv eeifnpdigmftydestklfwfnpssfetegqftligivlglaiynncildvhfpmvvyr klmgkkgtfrdlgdshpvlyqslkdlleyegnveddmmitfqisqtdlfgnpmmydlken gdkipitnenrkefvnlysdyilnksvekqfkafrrgfhmvtnesplkylfrpeeielli cgsrnldfqaleetteydggytrdsvlirefweivhsftdeqkrlflqfttgtdrapvgg lgklkmiiakngpdterlptshtcfnvlllpeysskeklkerllkaitya
Timeline for d1c4za_: