Lineage for d7b2cf_ (7b2c F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955026Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2955165Family d.58.31.0: automated matches [227271] (1 protein)
    not a true family
  6. 2955166Protein automated matches [227074] (6 species)
    not a true protein
  7. 2955167Species Candidatus ethanoperedens [TaxId:2766897] [420101] (2 PDB entries)
  8. 2955175Domain d7b2cf_: 7b2c F: [417628]
    Other proteins in same PDB: d7b2cb2, d7b2ce2
    automated match to d5n1qc_
    complexed with agm, cl, com, gl3, gol, hic, i2m, k, mg, mgn, na, smc, tp7, trs, usn, uwt, xe

Details for d7b2cf_

PDB Entry: 7b2c (more details), 1.8 Å

PDB Description: crystal structure of the ethyl-coenzyme m reductase from candidatus ethanoperedens thermophilum gassed with xenon
PDB Compounds: (F:) Ethyl-Coenzyme M reductase gamma subunit

SCOPe Domain Sequences for d7b2cf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7b2cf_ d.58.31.0 (F:) automated matches {Candidatus ethanoperedens [TaxId: 2766897]}
vyqrqflpaddrvtknrkkvvdpsvklekirtlsdkdfltlighrhlgeayrsvnpplae
igepedpirelvpptegakagdrvctiimtdsvynppiahytrawmyhnrfrgidngvys
grvtlemrerdleeacrtlfeteicdasrdqvrqytctghscrldpdgmmfdpiercims
ggnvvyqkdsfgnpvdtpinmgkplseeeliertvvyrtdrgepmtregdpgapdeevre
alqwsrriqwlrmlgnmvpdkikgm

SCOPe Domain Coordinates for d7b2cf_:

Click to download the PDB-style file with coordinates for d7b2cf_.
(The format of our PDB-style files is described here.)

Timeline for d7b2cf_:

  • d7b2cf_ is new in SCOPe 2.08-stable