![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
![]() | Family d.58.31.0: automated matches [227271] (1 protein) not a true family |
![]() | Protein automated matches [227074] (6 species) not a true protein |
![]() | Species Candidatus ethanoperedens [TaxId:2766897] [420101] (2 PDB entries) |
![]() | Domain d7b2cf_: 7b2c F: [417628] Other proteins in same PDB: d7b2cb2, d7b2ce2 automated match to d5n1qc_ complexed with agm, cl, com, gl3, gol, hic, i2m, k, mg, mgn, na, smc, tp7, trs, usn, uwt, xe |
PDB Entry: 7b2c (more details), 1.8 Å
SCOPe Domain Sequences for d7b2cf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7b2cf_ d.58.31.0 (F:) automated matches {Candidatus ethanoperedens [TaxId: 2766897]} vyqrqflpaddrvtknrkkvvdpsvklekirtlsdkdfltlighrhlgeayrsvnpplae igepedpirelvpptegakagdrvctiimtdsvynppiahytrawmyhnrfrgidngvys grvtlemrerdleeacrtlfeteicdasrdqvrqytctghscrldpdgmmfdpiercims ggnvvyqkdsfgnpvdtpinmgkplseeeliertvvyrtdrgepmtregdpgapdeevre alqwsrriqwlrmlgnmvpdkikgm
Timeline for d7b2cf_: