| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.0: automated matches [227271] (1 protein) not a true family |
| Protein automated matches [227074] (6 species) not a true protein |
| Species Candidatus ethanoperedens [TaxId:2766897] [420101] (2 PDB entries) |
| Domain d7b1se1: 7b1s E:2-212 [417620] Other proteins in same PDB: d7b1sb2, d7b1se2 automated match to d7nkgb1 complexed with agm, cl, com, gl3, gol, hic, i2m, k, mgn, mhs, mn, smc, tp7, trs, usn, uut |
PDB Entry: 7b1s (more details), 0.99 Å
SCOPe Domain Sequences for d7b1se1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7b1se1 d.58.31.0 (E:2-212) automated matches {Candidatus ethanoperedens [TaxId: 2766897]}
ayltekidlygdngkvlesdipleavtpvqnpavrelasifkrsvavnlggaqkalstgh
yaneyihfpdipnkdklgiksspggkyppksvkvrtmdlplvddaddiaarlkerlqvnp
ddgtevrvmkkgnvlyvkiseqlantgveyttaltttaqamtdlvmekydldfhasplvh
cafygrypqtyefmggnvisllaascanegp
Timeline for d7b1se1:
View in 3DDomains from other chains: (mouse over for more information) d7b1sb1, d7b1sb2, d7b1sc_, d7b1sf_ |