SCOPe 2.08: Domain d7b1se1: 7b1s E:2-212

Lineage for d7b1se1 (7b1s E:2-212)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.0: automated matches [227271] (1 protein)
   not a true family

6. Protein automated matches [227074] (6 species)
   not a true protein

7. Species Candidatus ethanoperedens [TaxId:2766897] [420101] (2 PDB entries)

8. Domain d7b1se1: 7b1s E:2-212 [417620]
   Other proteins in same PDB: d7b1sb2, d7b1se2
   automated match to d7nkgb1
   complexed with agm, cl, com, gl3, gol, hic, i2m, k, mgn, mhs, mn, smc, tp7, trs, usn, uut

Details for d7b1se1

PDB Entry: 7b1s, 0.99 Å

PDB Description: crystal structure of the ethyl-coenzyme m reductase from candidatus ethanoperedens thermophilum at 0.994-a resolution

PDB Compounds: (E:) Ethyl-Coenzyme M reductase beta subunit

SCOPe Domain Sequences for d7b1se1:

Sequence; same for both SEQRES and ATOM records:

>d7b1se1 d.58.31.0 (E:2-212) automated matches {Candidatus ethanoperedens [TaxId: 2766897]}
ayltekidlygdngkvlesdipleavtpvqnpavrelasifkrsvavnlggaqkalstgh
yaneyihfpdipnkdklgiksspggkyppksvkvrtmdlplvddaddiaarlkerlqvnp
ddgtevrvmkkgnvlyvkiseqlantgveyttaltttaqamtdlvmekydldfhasplvh
cafygrypqtyefmggnvisllaascanegp

Timeline for d7b1se1:

• d7b1se1 is new in SCOPe 2.08-stable