SCOPe 2.08: Domain d7b1sb2: 7b1s B:213-467

Lineage for d7b1sb2 (7b1s B:213-467)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
   multihelical bundle; contains buried central helix

4. Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families)

5. Family a.89.1.0: automated matches [227272] (1 protein)
   not a true family

6. Protein automated matches [227075] (6 species)
   not a true protein

7. Species Candidatus ethanoperedens [TaxId:2766897] [420102] (2 PDB entries)

8. Domain d7b1sb2: 7b1s B:213-467 [417618]
   Other proteins in same PDB: d7b1sb1, d7b1sc_, d7b1se1, d7b1sf_
   automated match to d7nkgb2
   complexed with agm, cl, com, gl3, gol, hic, i2m, k, mgn, mhs, mn, smc, tp7, trs, usn, uut

Details for d7b1sb2

PDB Entry: 7b1s, 0.99 Å

PDB Description: crystal structure of the ethyl-coenzyme m reductase from candidatus ethanoperedens thermophilum at 0.994-a resolution

PDB Compounds: (B:) Ethyl-Coenzyme M reductase beta subunit

SCOPe Domain Sequences for d7b1sb2:

Sequence; same for both SEQRES and ATOM records:

>d7b1sb2 a.89.1.0 (B:213-467) automated matches {Candidatus ethanoperedens [TaxId: 2766897]}
gfamrnimanhivaatrkrtleavalsstleaighvemgdaigrwrrwqalvhacqglna
nnvvydlvkeaghgctgdvvaatvgraledgiisvkktlpsgykfytandpsmwnayvca
glvaavivnqgaaraaqgvsstllyfndliehetglphagygdgmgngvsfsffshaiyg
ggspgifsgnhivtrhskgfaipviaaavsldsgtavygpeatsglvgdifgevdlirrp
meaiasaaaeikdkf

Timeline for d7b1sb2:

• d7b1sb2 is new in SCOPe 2.08-stable