Lineage for d7az9a_ (7az9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826027Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2826028Protein Triosephosphate isomerase [51353] (21 species)
  7. 2826288Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51360] (13 PDB entries)
  8. 2826292Domain d7az9a_: 7az9 A: [417615]
    automated match to d1qdsa_
    complexed with pgh

Details for d7az9a_

PDB Entry: 7az9 (more details), 1.1 Å

PDB Description: perdeuterated e65q-tim complexed with phosphoglycolohydroxamate
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d7az9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7az9a_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
akpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpkyv
isaqnaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackqgf
mviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvatpe
qaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslkpe
frdiidatr

SCOPe Domain Coordinates for d7az9a_:

Click to download the PDB-style file with coordinates for d7az9a_.
(The format of our PDB-style files is described here.)

Timeline for d7az9a_:

  • d7az9a_ is new in SCOPe 2.08-stable