Lineage for d1fiqb2 (1fiq B:224-414)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36457Fold d.145: FAD-binding domain [56175] (1 superfamily)
  4. 36458Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 36503Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (2 proteins)
  6. 36513Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 36514Species Cow (Bos taurus) [TaxId:9913] [56192] (2 PDB entries)
  8. 36517Domain d1fiqb2: 1fiq B:224-414 [41760]
    Other proteins in same PDB: d1fiqa1, d1fiqa2, d1fiqb1, d1fiqc1, d1fiqc2

Details for d1fiqb2

PDB Entry: 1fiq (more details), 2.5 Å

PDB Description: crystal structure of xanthine oxidase from bovine milk

SCOP Domain Sequences for d1fiqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fiqb2 d.145.1.3 (B:224-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus)}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOP Domain Coordinates for d1fiqb2:

Click to download the PDB-style file with coordinates for d1fiqb2.
(The format of our PDB-style files is described here.)

Timeline for d1fiqb2: