Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.145: FAD-binding domain [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding domain [56176] (3 families) |
Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (4 proteins) |
Protein Xanthine oxidase, domain 3 (?) [56191] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [56192] (4 PDB entries) |
Domain d1fo4b6: 1fo4 B:192-414 [41759] Other proteins in same PDB: d1fo4a1, d1fo4a2, d1fo4a3, d1fo4a4, d1fo4a5, d1fo4b1, d1fo4b2, d1fo4b3, d1fo4b4, d1fo4b5 |
PDB Entry: 1fo4 (more details), 2.1 Å
SCOP Domain Sequences for d1fo4b6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fo4b6 d.145.1.3 (B:192-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus)} spslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaq hpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvekt lleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtk ltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre
Timeline for d1fo4b6: