Lineage for d1ffvc2 (1ffv C:1-177)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512542Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 512543Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 512608Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (4 proteins)
  6. 512609Protein Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain [56188] (2 species)
  7. 512610Species Hydrogenophaga pseudoflava [TaxId:47421] [56190] (2 PDB entries)
  8. 512611Domain d1ffvc2: 1ffv C:1-177 [41754]
    Other proteins in same PDB: d1ffva1, d1ffva2, d1ffvb1, d1ffvb2, d1ffvc1, d1ffvd1, d1ffvd2, d1ffve1, d1ffve2, d1ffvf1

Details for d1ffvc2

PDB Entry: 1ffv (more details), 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava

SCOP Domain Sequences for d1ffvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffvc2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Hydrogenophaga pseudoflava}
mipprfeyhapksvgeavallgqlgsdakllagghsllpmmklrfaqpehlidinripel
rgireegstvvigamtvendlisspivqarlpllaeaakliadpqvrnrgtiggdiahgd
pgndhpalsiaveahfvlegpngrrtvpadgfflgtymtlleenevmveirvpafaq

SCOP Domain Coordinates for d1ffvc2:

Click to download the PDB-style file with coordinates for d1ffvc2.
(The format of our PDB-style files is described here.)

Timeline for d1ffvc2: