Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [407303] (2 PDB entries) |
Domain d6zzgi_: 6zzg I: [417473] automated match to d6tlcc_ complexed with act |
PDB Entry: 6zzg (more details), 2.93 Å
SCOPe Domain Sequences for d6zzgi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zzgi_ b.1.2.0 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vssvptklevvaatptslliswdapavtvylyvitygetggnspvqefevpgskstatis glkpgvdytitvyasskhssryaspisinyrt
Timeline for d6zzgi_: