Lineage for d6zzgi_ (6zzg I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762408Species Mouse (Mus musculus) [TaxId:10090] [407303] (2 PDB entries)
  8. 2762412Domain d6zzgi_: 6zzg I: [417473]
    automated match to d6tlcc_
    complexed with act

Details for d6zzgi_

PDB Entry: 6zzg (more details), 2.93 Å

PDB Description: mb_crs6-1 bound to crsas-6_n
PDB Compounds: (I:) mb_crs6-15

SCOPe Domain Sequences for d6zzgi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zzgi_ b.1.2.0 (I:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vssvptklevvaatptslliswdapavtvylyvitygetggnspvqefevpgskstatis
glkpgvdytitvyasskhssryaspisinyrt

SCOPe Domain Coordinates for d6zzgi_:

Click to download the PDB-style file with coordinates for d6zzgi_.
(The format of our PDB-style files is described here.)

Timeline for d6zzgi_:

  • d6zzgi_ is new in SCOPe 2.08-stable