SCOPe 2.08: Domain d6zyhb2: 6zyh B:218-406

Lineage for d6zyhb2 (6zyh B:218-406)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [364473] (3 PDB entries)

8. Domain d6zyhb2: 6zyh B:218-406 [417466]
   automated match to d6gfaa2
   complexed with adp, ca

Details for d6zyhb2

PDB Entry: 6zyh, 1.88 Å

PDB Description: crystal structure of grp78 (70kda heat shock protein 5 / bip) atpase domain in complex with adp and calcium

PDB Compounds: (B:) Endoplasmic reticulum chaperone BiP

SCOPe Domain Sequences for d6zyhb2:

Sequence; same for both SEQRES and ATOM records:

>d6zyhb2 c.55.1.0 (B:218-406) automated matches {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
knilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfiklykkktgkd
vrkdnravqklrrevekakralssqhqarieiesffegedfsetltrakfeelnmdlfrs
tmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrginpdeavayg
aavqagvls

Timeline for d6zyhb2:

• d6zyhb2 is new in SCOPe 2.08-stable