Lineage for d6zyha2 (6zyh A:218-406)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2884952Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [364473] (3 PDB entries)
  8. 2884956Domain d6zyha2: 6zyh A:218-406 [417464]
    automated match to d6gfaa2
    complexed with adp, ca

Details for d6zyha2

PDB Entry: 6zyh (more details), 1.88 Å

PDB Description: crystal structure of grp78 (70kda heat shock protein 5 / bip) atpase domain in complex with adp and calcium
PDB Compounds: (A:) Endoplasmic reticulum chaperone BiP

SCOPe Domain Sequences for d6zyha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zyha2 c.55.1.0 (A:218-406) automated matches {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
knilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfiklykkktgkd
vrkdnravqklrrevekakralssqhqarieiesffegedfsetltrakfeelnmdlfrs
tmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrginpdeavayg
aavqagvls

SCOPe Domain Coordinates for d6zyha2:

Click to download the PDB-style file with coordinates for d6zyha2.
(The format of our PDB-style files is described here.)

Timeline for d6zyha2:

  • d6zyha2 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6zyha1