Lineage for d1f0xa2 (1f0x A:9-273)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 263140Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 263141Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 263142Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (4 proteins)
  6. 263147Protein D-lactate dehydrogenase [56182] (1 species)
  7. 263148Species Escherichia coli [TaxId:562] [56183] (1 PDB entry)
  8. 263149Domain d1f0xa2: 1f0x A:9-273 [41746]
    Other proteins in same PDB: d1f0xa1, d1f0xb1

Details for d1f0xa2

PDB Entry: 1f0x (more details), 1.9 Å

PDB Description: crystal structure of d-lactate dehydrogenase, a peripheral membrane respiratory enzyme.

SCOP Domain Sequences for d1f0xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f0xa2 d.145.1.1 (A:9-273) D-lactate dehydrogenase {Escherichia coli}
nkaflnelarlvgsshlltdpaktaryrkgfrsgqgdalavvfpgsllelwrvlkacvta
dkiilmqaantgltegstpngndydrdvviistlrldklhvlgkgeqvlaypgttlysle
kalkplgrephsvigsscigasviggicnnsggslvqrgpaytemslfarinedgkltlv
nhlgidlgetpeqilskldddrikdddvrhdgrhahdydyvhrvrdieadtparynadpd
rlfessgcagklavfavrldtfeae

SCOP Domain Coordinates for d1f0xa2:

Click to download the PDB-style file with coordinates for d1f0xa2.
(The format of our PDB-style files is described here.)

Timeline for d1f0xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f0xa1