Lineage for d1diib2 (1dii B:7-242)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 335331Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 335332Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 335333Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (4 proteins)
  6. 335342Protein Flavoprotein subunit of p-cresol methylhydroxylase [56180] (1 species)
    the other subunit is a short-chain cytochrome c
  7. 335343Species Pseudomonas putida [TaxId:303] [56181] (2 PDB entries)
  8. 335347Domain d1diib2: 1dii B:7-242 [41745]
    Other proteins in same PDB: d1diia1, d1diib1, d1diic_, d1diid_

Details for d1diib2

PDB Entry: 1dii (more details), 2.5 Å

PDB Description: crystal structure of p-cresol methylhydroxylase at 2.5 a resolution

SCOP Domain Sequences for d1diib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diib2 d.145.1.1 (B:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida}
avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp

SCOP Domain Coordinates for d1diib2:

Click to download the PDB-style file with coordinates for d1diib2.
(The format of our PDB-style files is described here.)

Timeline for d1diib2: