SCOPe 2.08: Domain d6zurb_: 6zur B:

Lineage for d6zurb_ (6zur B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (166 species)
   not a true protein

7. Species Psychrobacter sp. [TaxId:408968] [269853] (6 PDB entries)

8. Domain d6zurb_: 6zur B: [417440]
   automated match to d6t3va_
   complexed with mg, no3, plp, tyf

Details for d6zurb_

PDB Entry: 6zur, 2.31 Å

PDB Description: psychrophilic aromatic amino acids aminotransferase from psychrobacter sp. b6 cocrystalized with substrate analog - l-p-hydroxyphenyllactic acid

PDB Compounds: (B:) aminotransferase

SCOPe Domain Sequences for d6zurb_:

Sequence; same for both SEQRES and ATOM records:

>d6zurb_ c.67.1.0 (B:) automated matches {Psychrobacter sp. [TaxId: 408968]}
mferidyyagdpilglvekfaadnnpdkvnlgigiyydesgvmpvldcvkiaeqriadpi
sprpylpmaglpghrkgcqellfgkdapvlkdglvatiatiggsgalkvgaefihewfpq
skcyvsdptwgnhiaifegcdievgkypyydtatggikfdemiaffetlnkddvlllhpc
chnptgvdltreqwdtvlnviqerelipfmdiayqgfgedmdsdayairkavdmglplfv
snsfsknlslygervgglsvvcptvdetervfgqlnstvrriyssppshggrvvdivmnd
aalheqwvgevyamrdriksmrtklksvleakisgrnfdyltaqngmfsftgltpeqver
lqsefgiymisnsrmcvaglnssnidyvanamvdvlkd

Timeline for d6zurb_:

• d6zurb_ is new in SCOPe 2.08-stable