Lineage for d1diqa2 (1diq A:7-242)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84620Fold d.145: FAD-binding domain [56175] (1 superfamily)
  4. 84621Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 84622Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (4 proteins)
  6. 84631Protein Flavoprotein subunit of p-cresol methylhydroxylase [56180] (1 species)
  7. 84632Species Pseudomonas putida [TaxId:303] [56181] (2 PDB entries)
  8. 84633Domain d1diqa2: 1diq A:7-242 [41742]
    Other proteins in same PDB: d1diqa1, d1diqb1, d1diqc_, d1diqd_

Details for d1diqa2

PDB Entry: 1diq (more details), 2.75 Å

PDB Description: crystal structure of p-cresol methylhydroxylase with substrate bound

SCOP Domain Sequences for d1diqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diqa2 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida}
avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp

SCOP Domain Coordinates for d1diqa2:

Click to download the PDB-style file with coordinates for d1diqa2.
(The format of our PDB-style files is described here.)

Timeline for d1diqa2: