SCOP 1.57: Domain d1ahzb2: 1ahz B:6-273

Lineage for d1ahzb2 (1ahz B:6-273)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.145: FAD-binding domain [56175] (1 superfamily)

4. Superfamily d.145.1: FAD-binding domain [56176] (3 families)

5. Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (4 proteins)

6. Protein Vanillyl-alcohol oxidase [56178] (1 species)

7. Species Fungus (Penicillium simplicissimum) [TaxId:69488] [56179] (12 PDB entries)

8. Domain d1ahzb2: 1ahz B:6-273 [41741]
   Other proteins in same PDB: d1ahza1, d1ahzb1

Details for d1ahzb2

PDB Entry: 1ahz, 3.3 Å

PDB Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with 4-(1-heptenyl)phenol

SCOP Domain Sequences for d1ahzb2:

Sequence; same for both SEQRES and ATOM records:

>d1ahzb2 d.145.1.1 (B:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum)}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

Timeline for d1ahzb2:

• d1ahzb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ahzb2 appears in SCOP 1.59
  
• d1ahzb2 appears in the current release, SCOPe 2.08