Lineage for d1ahza2 (1ahz A:6-273)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987461Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)
  6. 2987497Protein Vanillyl-alcohol oxidase [56178] (1 species)
  7. 2987498Species Fungus (Penicillium simplicissimum) [TaxId:69488] [56179] (16 PDB entries)
    Uniprot P56216
  8. 2987523Domain d1ahza2: 1ahz A:6-273 [41740]
    Other proteins in same PDB: d1ahza1, d1ahzb1
    complexed with cl, ept, fad

Details for d1ahza2

PDB Entry: 1ahz (more details), 3.3 Å

PDB Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with 4-(1-heptenyl)phenol
PDB Compounds: (A:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d1ahza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahza2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

SCOPe Domain Coordinates for d1ahza2:

Click to download the PDB-style file with coordinates for d1ahza2.
(The format of our PDB-style files is described here.)

Timeline for d1ahza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ahza1