SCOPe 2.08: Domain d6zd3b1: 6zd3 B:345-508

Lineage for d6zd3b1 (6zd3 B:345-508)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.0: automated matches [191599] (1 protein)
   not a true family

6. Protein automated matches [191089] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189059] (71 PDB entries)

8. Domain d6zd3b1: 6zd3 B:345-508 [417363]
   Other proteins in same PDB: d6zd3a2, d6zd3b2
   automated match to d4u8ta_
   protein/RNA complex; complexed with peg, so4; mutant

Details for d6zd3b1

PDB Entry: 6zd3, 1.25 Å

PDB Description: crystal structure of ythdc1 m438a mutant

PDB Compounds: (B:) YTH domain containing 1

SCOPe Domain Sequences for d6zd3b1:

Sequence, based on SEQRES records:

>d6zd3b1 b.122.1.0 (B:345-508) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsklkyvlqdarffliksnnhenvslakakgvwstlpvnekklnlafrsarsvilifsvr
esgkfqgfarlsseshhggspihwvlpagmsakalggvfkidwicrrelpftksahltnp
wnehkpvkigrdgqeielecgtqlcllfppdesidlyqvihkmr

Sequence, based on observed residues (ATOM records):

>d6zd3b1 b.122.1.0 (B:345-508) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsklkyvlqdarffliksnnhenvslakakgvwstlpvnekklnlafrsarsvilifsvr
esgkfqgfarlsseshhggspihwvlpggvfkidwicrrelpftksahltnpwnehkpvk
igrdgqeielecgtqlcllfppdesidlyqvihkmr

Timeline for d6zd3b1:

• d6zd3b1 is new in SCOPe 2.08-stable