Lineage for d1dzna2 (1dzn A:6-273)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84620Fold d.145: FAD-binding domain [56175] (1 superfamily)
  4. 84621Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 84622Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (4 proteins)
  6. 84637Protein Vanillyl-alcohol oxidase [56178] (1 species)
  7. 84638Species Fungus (Penicillium simplicissimum) [TaxId:69488] [56179] (12 PDB entries)
  8. 84655Domain d1dzna2: 1dzn A:6-273 [41734]
    Other proteins in same PDB: d1dzna1, d1dznb1

Details for d1dzna2

PDB Entry: 1dzn (more details), 2.8 Å

PDB Description: asp170ser mutant of vanillyl-alcohol oxidase

SCOP Domain Sequences for d1dzna2:

Sequence, based on SEQRES records: (download)

>d1dzna2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum)}
afrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpslgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

Sequence, based on observed residues (ATOM records): (download)

>d1dzna2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum)}
afrpltlppklslsdfnefiqdiirivgsenvevisvdgsymkpththdphhvmdqdyfl
asaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrv
levnvegaycvvepgvtyhdlhnyleannlrdklwldvpslgggsvlgnavergvgytpy
gdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyi
dglfsqsnmgivtkigiwlmpnp

SCOP Domain Coordinates for d1dzna2:

Click to download the PDB-style file with coordinates for d1dzna2.
(The format of our PDB-style files is described here.)

Timeline for d1dzna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dzna1