Lineage for d1ahub2 (1ahu B:6-273)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84620Fold d.145: FAD-binding domain [56175] (1 superfamily)
  4. 84621Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 84622Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (4 proteins)
  6. 84637Protein Vanillyl-alcohol oxidase [56178] (1 species)
  7. 84638Species Fungus (Penicillium simplicissimum) [TaxId:69488] [56179] (12 PDB entries)
  8. 84654Domain d1ahub2: 1ahu B:6-273 [41733]
    Other proteins in same PDB: d1ahua1, d1ahub1

Details for d1ahub2

PDB Entry: 1ahu (more details), 2.7 Å

PDB Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with p-cresol

SCOP Domain Sequences for d1ahub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahub2 d.145.1.1 (B:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum)}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

SCOP Domain Coordinates for d1ahub2:

Click to download the PDB-style file with coordinates for d1ahub2.
(The format of our PDB-style files is described here.)

Timeline for d1ahub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ahub1