Lineage for d1ahua2 (1ahu A:6-273)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 263140Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 263141Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 263142Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (4 proteins)
  6. 263157Protein Vanillyl-alcohol oxidase [56178] (1 species)
  7. 263158Species Fungus (Penicillium simplicissimum) [TaxId:69488] [56179] (12 PDB entries)
  8. 263173Domain d1ahua2: 1ahu A:6-273 [41732]
    Other proteins in same PDB: d1ahua1, d1ahub1

Details for d1ahua2

PDB Entry: 1ahu (more details), 2.7 Å

PDB Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with p-cresol

SCOP Domain Sequences for d1ahua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahua2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum)}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

SCOP Domain Coordinates for d1ahua2:

Click to download the PDB-style file with coordinates for d1ahua2.
(The format of our PDB-style files is described here.)

Timeline for d1ahua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ahua1