SCOPe 2.08: Domain d1ahua2: 1ahu A:6-273

Lineage for d1ahua2 (1ahu A:6-273)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)

6. Protein Vanillyl-alcohol oxidase [56178] (1 species)

7. Species Fungus (Penicillium simplicissimum) [TaxId:69488] [56179] (16 PDB entries)
   Uniprot P56216

8. Domain d1ahua2: 1ahu A:6-273 [41732]
   Other proteins in same PDB: d1ahua1, d1ahub1
   complexed with faa

Details for d1ahua2

PDB Entry: 1ahu, 2.7 Å

PDB Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with p-cresol

PDB Compounds: (A:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d1ahua2:

Sequence; same for both SEQRES and ATOM records:

>d1ahua2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

Timeline for d1ahua2:

• d1ahua2 first appeared (with stable ids) in SCOP 1.55
  
• d1ahua2 appears in SCOPe 2.07