Lineage for d1e8hb2 (1e8h B:6-273)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36457Fold d.145: FAD-binding domain [56175] (1 superfamily)
  4. 36458Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 36459Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (3 proteins)
  6. 36470Protein Vanillyl-alcohol oxidase [56178] (1 species)
  7. 36471Species Fungus (Penicillium simplicissimum) [TaxId:69488] [56179] (12 PDB entries)
  8. 36483Domain d1e8hb2: 1e8h B:6-273 [41729]
    Other proteins in same PDB: d1e8ha1, d1e8hb1

Details for d1e8hb2

PDB Entry: 1e8h (more details), 2.6 Å

PDB Description: structure of the h61t mutant of the flavoenzyme vanillyl-alcohol oxidase in the apo form complexed by adp

SCOP Domain Sequences for d1e8hb2:

Sequence, based on SEQRES records: (download)

>d1e8hb2 d.145.1.1 (B:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum)}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdpthvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

Sequence, based on observed residues (ATOM records): (download)

>d1e8hb2 d.145.1.1 (B:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum)}
efrpltlppklslsdfnefiqdiirivgsenvevismkpththdpthvmdqdyflasaiv
aprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrvlevnv
egaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgytpygdhwm
mhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyidglfs
qsnmgivtkigiwlmpnp

SCOP Domain Coordinates for d1e8hb2:

Click to download the PDB-style file with coordinates for d1e8hb2.
(The format of our PDB-style files is described here.)

Timeline for d1e8hb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e8hb1