Lineage for d1ahvb2 (1ahv B:6-273)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)
  6. Protein Vanillyl-alcohol oxidase [56178] (1 species)
  7. Species Fungus (Penicillium simplicissimum) [TaxId:69488] [56179] (16 PDB entries)
    Uniprot P56216
  8. Domain d1ahvb2: 1ahv B:6-273 [41727]
    Other proteins in same PDB: d1ahva1, d1ahvb1
    complexed with fad, ncr

Details for d1ahvb2

PDB Entry: 1ahv (more details), 3.1 Å

PDB Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with 2-nitro-p-cresol
PDB Compounds: (B:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d1ahvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahvb2 d.145.1.1 (B:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

SCOPe Domain Coordinates for d1ahvb2 are not available.

Timeline for d1ahvb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ahvb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ahva1, d1ahva2