SCOPe 2.07: Domain d1ahva2: 1ahv A:6-273

Lineage for d1ahva2 (1ahv A:6-273)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)

6. Protein Vanillyl-alcohol oxidase [56178] (1 species)

7. Species Fungus (Penicillium simplicissimum) [TaxId:69488] [56179] (16 PDB entries)
   Uniprot P56216

8. Domain d1ahva2: 1ahv A:6-273 [41726]
   Other proteins in same PDB: d1ahva1, d1ahvb1
   complexed with fad, ncr

Details for d1ahva2

PDB Entry: 1ahv, 3.1 Å

PDB Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase in complex with 2-nitro-p-cresol

PDB Compounds: (A:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d1ahva2:

Sequence; same for both SEQRES and ATOM records:

>d1ahva2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

Timeline for d1ahva2:

• d1ahva2 first appeared (with stable ids) in SCOP 1.55
  
• d1ahva2 appears in SCOPe 2.06
  
• d1ahva2 appears in the current release, SCOPe 2.08