Lineage for d1qlua2 (1qlu A:6-273)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84620Fold d.145: FAD-binding domain [56175] (1 superfamily)
  4. 84621Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 84622Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (4 proteins)
  6. 84637Protein Vanillyl-alcohol oxidase [56178] (1 species)
  7. 84638Species Fungus (Penicillium simplicissimum) [TaxId:69488] [56179] (12 PDB entries)
  8. 84643Domain d1qlua2: 1qlu A:6-273 [41722]
    Other proteins in same PDB: d1qlua1, d1qlub1

Details for d1qlua2

PDB Entry: 1qlu (more details), 2.4 Å

PDB Description: structure of the h422a mutant vanillyl-alcohol oxidase in complex with isoeugenol

SCOP Domain Sequences for d1qlua2:

Sequence, based on SEQRES records: (download)

>d1qlua2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum)}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

Sequence, based on observed residues (ATOM records): (download)

>d1qlua2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum)}
efrpltlppklslsdfnefiqdiirivgsenvevisvdgsymkpththdphhvmdqdyfl
asaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrv
levnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgytpy
gdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyi
dglfsqsnmgivtkigiwlmpnp

SCOP Domain Coordinates for d1qlua2:

Click to download the PDB-style file with coordinates for d1qlua2.
(The format of our PDB-style files is described here.)

Timeline for d1qlua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qlua1