Lineage for d1he8a4 (1he8 A:726-1084)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220010Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (1 protein)
  6. 1220011Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 1220012Species Human (Homo sapiens) [TaxId:9606] [56174] (3 PDB entries)
  8. 1220015Domain d1he8a4: 1he8 A:726-1084 [41717]
    Other proteins in same PDB: d1he8a1, d1he8a2, d1he8a3, d1he8b_
    complexed with gnp, mg

Details for d1he8a4

PDB Entry: 1he8 (more details), 3 Å

PDB Description: ras g12v - pi 3-kinase gamma complex
PDB Compounds: (A:) phosphatidylinositol 3-kinase catalytic subunit, gamma isoform

SCOPe Domain Sequences for d1he8a4:

Sequence, based on SEQRES records: (download)

>d1he8a4 d.144.1.4 (A:726-1084) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqf

Sequence, based on observed residues (ATOM records): (download)

>d1he8a4 d.144.1.4 (A:726-1084) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
tamlhdftqqvqviemlqkvtldikslssqvisqlkqklenlqnsqlpesfrvpydpglk
agalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrime
siwetesldlcllpygcistgdkigmieivkdattiakiqqstfkdevlnhwlkekspte
ekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghervpfvltpdf
lfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtdieyirdaltvgkn
eedakkyfldqievcrdkgwtvqf

SCOPe Domain Coordinates for d1he8a4:

Click to download the PDB-style file with coordinates for d1he8a4.
(The format of our PDB-style files is described here.)

Timeline for d1he8a4: