Lineage for d1he8a4 (1he8 A:726-1084)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36445Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (1 protein)
  6. 36446Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 36447Species Human (Homo sapiens) [TaxId:9606] [56174] (3 PDB entries)
  8. 36450Domain d1he8a4: 1he8 A:726-1084 [41717]
    Other proteins in same PDB: d1he8a1, d1he8a2, d1he8a3, d1he8b_

Details for d1he8a4

PDB Entry: 1he8 (more details), 3 Å

PDB Description: ras g12v - pi 3-kinase gamma complex
PDB Compounds: (A:)

SCOP Domain Sequences for d1he8a4:

Sequence, based on SEQRES records: (download)

>d1he8a4 d.144.1.4 (A:726-1084) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens)}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqf

Sequence, based on observed residues (ATOM records): (download)

>d1he8a4 d.144.1.4 (A:726-1084) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens)}
tamlhdftqqvqviemlqkvtldikslssqvisqlkqklenlqnsqlpesfrvpydpglk
agalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrime
siwetesldlcllpygcistgdkigmieivkdattiakiqqstfkdevlnhwlkekspte
ekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghervpfvltpdf
lfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtdieyirdaltvgkn
eedakkyfldqievcrdkgwtvqf

SCOP Domain Coordinates for d1he8a4:

Click to download the PDB-style file with coordinates for d1he8a4.
(The format of our PDB-style files is described here.)

Timeline for d1he8a4: