Lineage for d1e8za4 (1e8z A:726-1092)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611844Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (1 protein)
  6. 611845Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 611846Species Human (Homo sapiens) [TaxId:9606] [56174] (3 PDB entries)
  8. 611848Domain d1e8za4: 1e8z A:726-1092 [41716]
    Other proteins in same PDB: d1e8za1, d1e8za2, d1e8za3
    complexed with stu; mutant

Details for d1e8za4

PDB Entry: 1e8z (more details), 2.4 Å

PDB Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine
PDB Compounds: (A:)

SCOP Domain Sequences for d1e8za4:

Sequence, based on SEQRES records: (download)

>d1e8za4 d.144.1.4 (A:726-1092) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens)}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfn
wflhlvl

Sequence, based on observed residues (ATOM records): (download)

>d1e8za4 d.144.1.4 (A:726-1092) Phoshoinositide 3-kinase (PI3K), catalytic domain {Human (Homo sapiens)}
tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgfkdev
lnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfg
hervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgm
pqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvl

SCOP Domain Coordinates for d1e8za4:

Click to download the PDB-style file with coordinates for d1e8za4.
(The format of our PDB-style files is described here.)

Timeline for d1e8za4: