Lineage for d6xswh_ (6xsw H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745381Species Norway rat (Rattus norvegicus) [TaxId:10116] [187415] (25 PDB entries)
  8. 2745415Domain d6xswh_: 6xsw H: [417159]
    Other proteins in same PDB: d6xswb_, d6xswe_, d6xswi_, d6xswl_
    automated match to d6shgh_
    complexed with ca, nag

Details for d6xswh_

PDB Entry: 6xsw (more details), 2.98 Å

PDB Description: structure of the notch3 nrr in complex with an antibody fab fragment
PDB Compounds: (H:) Anti-N3 Fab Heavy Chain

SCOPe Domain Sequences for d6xswh_:

Sequence, based on SEQRES records: (download)

>d6xswh_ b.1.1.1 (H:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evqlvesggglvqpggslrlscaasgyaftdywmtwvrqapgkglewvaeispnsggtnf
nekfkgrftisvdnaknslylqmnslraedtavyycargeirynwfaywgqgtlvtvssa
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records): (download)

>d6xswh_ b.1.1.1 (H:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evqlvesggglvqpggslrlscaasgyaftdywmtwvrqapgkglewvaeispnsggtnf
nekfkgrftisvdnaknslylqmnslraedtavyycargeirynwfaywgqgtlvtvssa
stkgpsvfplapsskggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d6xswh_:

Click to download the PDB-style file with coordinates for d6xswh_.
(The format of our PDB-style files is described here.)

Timeline for d6xswh_:

  • d6xswh_ is new in SCOPe 2.08-stable