Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [187415] (25 PDB entries) |
Domain d6xswd_: 6xsw D: [417156] Other proteins in same PDB: d6xswb_, d6xswe_, d6xswi_, d6xswl_ automated match to d6shgh_ complexed with ca, nag |
PDB Entry: 6xsw (more details), 2.98 Å
SCOPe Domain Sequences for d6xswd_:
Sequence, based on SEQRES records: (download)
>d6xswd_ b.1.1.1 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} evqlvesggglvqpggslrlscaasgyaftdywmtwvrqapgkglewvaeispnsggtnf nekfkgrftisvdnaknslylqmnslraedtavyycargeirynwfaywgqgtlvtvssa stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg lyslssvvtvpssslgtqtyicnvnhkpsntkvd
>d6xswd_ b.1.1.1 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} evqlvesggglvqpggslrlscaasgyaftdywmtwvrqapgkglewvaeispnsggtnf nekfkgrftisvdnaknslylqmnslraedtavyycargeirynwfaywgqgtlvtvssa stkgpsvclvkdyfpepvtvswnhtfpavlqssglyslssvvtvpssslyicnvnhkpsn tkvd
Timeline for d6xswd_: