Lineage for d6xqxb_ (6xqx B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014879Species Neisseria gonorrhoeae [TaxId:485] [225541] (16 PDB entries)
  8. 3014893Domain d6xqxb_: 6xqx B: [417119]
    Other proteins in same PDB: d6xqxa2
    automated match to d5uy7a_
    complexed with edo, so4; mutant

Details for d6xqxb_

PDB Entry: 6xqx (more details), 2.15 Å

PDB Description: crystal structure of the catalytic domain of pbp2 s310a from neisseria gonorrhoeae with the h514a mutation at ph 7.5
PDB Compounds: (B:) Probable peptidoglycan D,D-transpeptidase PenA

SCOPe Domain Sequences for d6xqxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xqxb_ e.3.1.0 (B:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
lsldqriqtlayeelnkaveyhqakagtvvvldartgeilalantpggrnravtdmiepg
aaikpfviakaldagktdlnerlntqpykigpspvrdthvypsldvrgimqkssnvgtsk
lsarfgaeemydfyhelgigvrmhsgfpgetagllrnwrrwrpieqatmsfgyglqlsll
qlaraytalthdgvllplsfekqavapqgkrifkestarevrnlmvsvtepggtgtagav
dgfdvgaktgtarkfvngryadnkavatfigfapaknprvivavtideptahgyyggvva
gppfkkimggslnilgisptkplta

SCOPe Domain Coordinates for d6xqxb_:

Click to download the PDB-style file with coordinates for d6xqxb_.
(The format of our PDB-style files is described here.)

Timeline for d6xqxb_:

  • d6xqxb_ is new in SCOPe 2.08-stable