Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:485] [225541] (16 PDB entries) |
Domain d6xqxb_: 6xqx B: [417119] Other proteins in same PDB: d6xqxa2 automated match to d5uy7a_ complexed with edo, so4; mutant |
PDB Entry: 6xqx (more details), 2.15 Å
SCOPe Domain Sequences for d6xqxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xqxb_ e.3.1.0 (B:) automated matches {Neisseria gonorrhoeae [TaxId: 485]} lsldqriqtlayeelnkaveyhqakagtvvvldartgeilalantpggrnravtdmiepg aaikpfviakaldagktdlnerlntqpykigpspvrdthvypsldvrgimqkssnvgtsk lsarfgaeemydfyhelgigvrmhsgfpgetagllrnwrrwrpieqatmsfgyglqlsll qlaraytalthdgvllplsfekqavapqgkrifkestarevrnlmvsvtepggtgtagav dgfdvgaktgtarkfvngryadnkavatfigfapaknprvivavtideptahgyyggvva gppfkkimggslnilgisptkplta
Timeline for d6xqxb_: