Lineage for d6xp6d1 (6xp6 D:0-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938770Domain d6xp6d1: 6xp6 D:0-81 [417105]
    Other proteins in same PDB: d6xp6a2, d6xp6b2, d6xp6d2, d6xp6e2, d6xp6g_, d6xp6h_, d6xp6i_, d6xp6j_
    automated match to d5ujta1
    complexed with cl, ipa, nag

Details for d6xp6d1

PDB Entry: 6xp6 (more details), 2.4 Å

PDB Description: 3c11-dq2-glia-a2 complex
PDB Compounds: (D:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d6xp6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xp6d1 d.19.1.0 (D:0-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfa
ltniavlkhnlnslikrsnsta

SCOPe Domain Coordinates for d6xp6d1:

Click to download the PDB-style file with coordinates for d6xp6d1.
(The format of our PDB-style files is described here.)

Timeline for d6xp6d1:

  • d6xp6d1 is new in SCOPe 2.08-stable

2938770
d6xp6d1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6xp6d2