Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d6xp6a2: 6xp6 A:82-181 [417102] Other proteins in same PDB: d6xp6a1, d6xp6b1, d6xp6b2, d6xp6d1, d6xp6e1, d6xp6e2, d6xp6g_, d6xp6h_, d6xp6i_, d6xp6j_ automated match to d5ujta2 complexed with cl, ipa, nag |
PDB Entry: 6xp6 (more details), 2.4 Å
SCOPe Domain Sequences for d6xp6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xp6a2 b.1.1.2 (A:82-181) automated matches {Human (Homo sapiens) [TaxId: 9606]} atnevpevtvfskspvtlgqpniliclvdnifppvvnitwlsnghsvtegvsetsflsks dhsffkisyltllpsaeesydckvehwgldkpllkhwepe
Timeline for d6xp6a2: