Lineage for d1e7ua4 (1e7u A:726-1094)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36445Family d.144.1.4: Phoshoinositide 3-kinase (PI3K), catalytic domain [56171] (1 protein)
  6. 36446Protein Phoshoinositide 3-kinase (PI3K), catalytic domain [56172] (2 species)
  7. 36451Species Pig (Sus scrofa) [TaxId:9823] [56173] (5 PDB entries)
  8. 36452Domain d1e7ua4: 1e7u A:726-1094 [41710]
    Other proteins in same PDB: d1e7ua1, d1e7ua2, d1e7ua3

Details for d1e7ua4

PDB Entry: 1e7u (more details), 2 Å

PDB Description: structure determinants of phosphoinositide 3-kinase inhibition by wortmannin, ly294002, quercetin, myricetin and staurosporine
PDB Compounds: (A:)

SCOP Domain Sequences for d1e7ua4:

Sequence, based on SEQRES records: (download)

>d1e7ua4 d.144.1.4 (A:726-1094) Phoshoinositide 3-kinase (PI3K), catalytic domain {Pig (Sus scrofa)}
tamlhdftqqvqvidmlqkvtidikslsaekydvssqvisqlkqklenlqnlnlpqsfrv
pydpglkagalviekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlshwlkekcpieekfqaaverfvyscagycvatfvlgigdrhndnimisetgnlfhidf
ghilgnyksflginkervpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtn
lliilfsmmlmtgmpqltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfn
wflhlvlgi

Sequence, based on observed residues (ATOM records): (download)

>d1e7ua4 d.144.1.4 (A:726-1094) Phoshoinositide 3-kinase (PI3K), catalytic domain {Pig (Sus scrofa)}
tamlhdftqqvqvidmlqkvtidikslsaekydvssqvisqlkqklenlqnlnlpqsfrv
pydpglkagalviekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
vlshwlkekcpieekfqaaverfvyscagycvatfvlgigdrhndnimisetgnlfhidf
ghinkervpfvltpdflfvmgtsgkktslhfqkfqdvcvkaylalrhhtnlliilfsmml
mtgmpqltskedieyirdaltvgkseedakkyfldqievcrdkgwtvqfnwflhlvlgi

SCOP Domain Coordinates for d1e7ua4:

Click to download the PDB-style file with coordinates for d1e7ua4.
(The format of our PDB-style files is described here.)

Timeline for d1e7ua4: