Lineage for d1cjab_ (1cja B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36440Family d.144.1.3: Atypical protein kinases [56168] (1 protein)
  6. 36441Protein Actin-fragmin kinase [56169] (1 species)
  7. 36442Species Slime mold (Physarum polycephalum) [TaxId:5791] [56170] (1 PDB entry)
  8. 36444Domain d1cjab_: 1cja B: [41709]

Details for d1cjab_

PDB Entry: 1cja (more details), 2.9 Å

PDB Description: actin-fragmin kinase, catalytic domain from physarum polycephalum

SCOP Domain Sequences for d1cjab_:

Sequence, based on SEQRES records: (download)

>d1cjab_ d.144.1.3 (B:) Actin-fragmin kinase {Slime mold (Physarum polycephalum)}
agalweiekelftklpapssainshlqpakpkvpqkkpskwdppaefkvdlstavsyndi
gdinwknlqqfkgiersekgteglffvetesgvfivkrstniesetfcsllcmrlglhap
kvrvvssnseegtnmleclaaidksfrvittlanqanillmelvrgitlnkltttsapev
ltkstmqqlgslmaldvivnnsdrlpiawtnegnldnimlsergatvvpidskiipldas
hphgervrellrtliahpghessqfhsirdiitlytgydvgtegsismqegflatvreca
sfdldaferellswqeslqkchnlsispqaipfilrmlrifh

Sequence, based on observed residues (ATOM records): (download)

>d1cjab_ d.144.1.3 (B:) Actin-fragmin kinase {Slime mold (Physarum polycephalum)}
agalweiekelftklpapssainshlqpakpfkvdlstavsyndigdinwknlqqfkgie
rsekgteglffvetesgvfivkrstniesetfcsllcmrlglhapkvrvvssnseegtnm
leclaaidksfrvittlanqanillmelvrgitlnkltttsapevltkstmqqlgslmal
dvivnnsdrlpiawtnegnldnimlsergatvvpidskiipldashphgervrellrtli
ahpghessqfhsirdiitlytgydvgtegsismqegflatvrecasfdldaferellswq
eslqkchnlsispqaipfilrmlrifh

SCOP Domain Coordinates for d1cjab_:

Click to download the PDB-style file with coordinates for d1cjab_.
(The format of our PDB-style files is described here.)

Timeline for d1cjab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cjaa_