Class g: Small proteins [56992] (100 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
Protein TGF-beta2 [57510] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [57511] (6 PDB entries) |
Domain d6xm2i_: 6xm2 I: [417083] Other proteins in same PDB: d6xm2a_, d6xm2b_, d6xm2c_, d6xm2d_, d6xm2e_, d6xm2f_, d6xm2g_, d6xm2h_ automated match to d1tfga_ |
PDB Entry: 6xm2 (more details), 1.91 Å
SCOPe Domain Sequences for d6xm2i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xm2i_ g.17.1.2 (I:) TGF-beta2 {Human (Homo sapiens) [TaxId: 9606]} aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs
Timeline for d6xm2i_: