Lineage for d6xm2i_ (6xm2 I:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033672Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)
  6. 3033759Protein TGF-beta2 [57510] (2 species)
  7. 3033760Species Human (Homo sapiens) [TaxId:9606] [57511] (6 PDB entries)
  8. 3033761Domain d6xm2i_: 6xm2 I: [417083]
    Other proteins in same PDB: d6xm2a_, d6xm2b_, d6xm2c_, d6xm2d_, d6xm2e_, d6xm2f_, d6xm2g_, d6xm2h_
    automated match to d1tfga_

Details for d6xm2i_

PDB Entry: 6xm2 (more details), 1.91 Å

PDB Description: the structure of the 4a11.v7 antibody in complex with human tgfb2
PDB Compounds: (I:) Transforming growth factor beta-2

SCOPe Domain Sequences for d6xm2i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xm2i_ g.17.1.2 (I:) TGF-beta2 {Human (Homo sapiens) [TaxId: 9606]}
aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs

SCOPe Domain Coordinates for d6xm2i_:

Click to download the PDB-style file with coordinates for d6xm2i_.
(The format of our PDB-style files is described here.)

Timeline for d6xm2i_:

  • d6xm2i_ is new in SCOPe 2.08-stable