Lineage for d1cjaa_ (1cja A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84393Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 84394Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 84586Family d.144.1.3: Actin-fragmin kinase, catalytic domain [56168] (1 protein)
  6. 84587Protein Actin-fragmin kinase, catalytic domain [56169] (1 species)
  7. 84588Species Slime mold (Physarum polycephalum) [TaxId:5791] [56170] (1 PDB entry)
  8. 84589Domain d1cjaa_: 1cja A: [41708]

Details for d1cjaa_

PDB Entry: 1cja (more details), 2.9 Å

PDB Description: actin-fragmin kinase, catalytic domain from physarum polycephalum

SCOP Domain Sequences for d1cjaa_:

Sequence, based on SEQRES records: (download)

>d1cjaa_ d.144.1.3 (A:) Actin-fragmin kinase, catalytic domain {Slime mold (Physarum polycephalum)}
agalweiekelftklpapssainshlqpakpkvpqkkpskwdppaefkvdlstavsyndi
gdinwknlqqfkgiersekgteglffvetesgvfivkrstniesetfcsllcmrlglhap
kvrvvssnseegtnmleclaaidksfrvittlanqanillmelvrgitlnkltttsapev
ltkstmqqlgslmaldvivnnsdrlpiawtnegnldnimlsergatvvpidskiipldas
hphgervrellrtliahpghessqfhsirdiitlytgydvgtegsismqegflatvreca
sfdldaferellswqeslqkchnlsispqaipfilrmlrifh

Sequence, based on observed residues (ATOM records): (download)

>d1cjaa_ d.144.1.3 (A:) Actin-fragmin kinase, catalytic domain {Slime mold (Physarum polycephalum)}
agalweiekelftklpapssainshlqpakpfkvdlstavsyndigdinwknlqqfkgie
rsekgteglffvetesgvfivkrstniesetfcsllcmrlglhapkvrvvssnseegtnm
leclaaidksfrvittlanqanillmelvrgitlnkltttsapevltkstmqqlgslmal
dvivnnsdrlpiawtnegnldnimlsergatvvpidskiipldashphgervrellrtli
ahpghessqfhsirdiitlytgydvgtegsismqegflatvrecasfdldaferellswq
eslqkchnlsispqaipfilrmlrifh

SCOP Domain Coordinates for d1cjaa_:

Click to download the PDB-style file with coordinates for d1cjaa_.
(The format of our PDB-style files is described here.)

Timeline for d1cjaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cjab_