Lineage for d1cjaa_ (1cja A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979547Family d.144.1.3: Actin-fragmin kinase, catalytic domain [56168] (1 protein)
    Atypical protein kinases
  6. 2979548Protein Actin-fragmin kinase, catalytic domain [56169] (1 species)
  7. 2979549Species Slime mold (Physarum polycephalum) [TaxId:5791] [56170] (1 PDB entry)
  8. 2979550Domain d1cjaa_: 1cja A: [41708]
    complexed with amp

Details for d1cjaa_

PDB Entry: 1cja (more details), 2.9 Å

PDB Description: actin-fragmin kinase, catalytic domain from physarum polycephalum
PDB Compounds: (A:) protein (actin-fragmin kinase)

SCOPe Domain Sequences for d1cjaa_:

Sequence, based on SEQRES records: (download)

>d1cjaa_ d.144.1.3 (A:) Actin-fragmin kinase, catalytic domain {Slime mold (Physarum polycephalum) [TaxId: 5791]}
agalweiekelftklpapssainshlqpakpkvpqkkpskwdppaefkvdlstavsyndi
gdinwknlqqfkgiersekgteglffvetesgvfivkrstniesetfcsllcmrlglhap
kvrvvssnseegtnmleclaaidksfrvittlanqanillmelvrgitlnkltttsapev
ltkstmqqlgslmaldvivnnsdrlpiawtnegnldnimlsergatvvpidskiipldas
hphgervrellrtliahpghessqfhsirdiitlytgydvgtegsismqegflatvreca
sfdldaferellswqeslqkchnlsispqaipfilrmlrifh

Sequence, based on observed residues (ATOM records): (download)

>d1cjaa_ d.144.1.3 (A:) Actin-fragmin kinase, catalytic domain {Slime mold (Physarum polycephalum) [TaxId: 5791]}
agalweiekelftklpapssainshlqpakpfkvdlstavsyndigdinwknlqqfkgie
rsekgteglffvetesgvfivkrstniesetfcsllcmrlglhapkvrvvssnseegtnm
leclaaidksfrvittlanqanillmelvrgitlnkltttsapevltkstmqqlgslmal
dvivnnsdrlpiawtnegnldnimlsergatvvpidskiipldashphgervrellrtli
ahpghessqfhsirdiitlytgydvgtegsismqegflatvrecasfdldaferellswq
eslqkchnlsispqaipfilrmlrifh

SCOPe Domain Coordinates for d1cjaa_:

Click to download the PDB-style file with coordinates for d1cjaa_.
(The format of our PDB-style files is described here.)

Timeline for d1cjaa_: