Lineage for d1fpub_ (1fpu B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36394Family d.144.1.2: Tyrosine kinase [56150] (8 proteins)
  6. 36395Protein Abelsone tyrosine kinase (abl) [56166] (1 species)
  7. 36396Species Mouse (Mus musculus) [TaxId:10090] [56167] (1 PDB entry)
  8. 36398Domain d1fpub_: 1fpu B: [41707]

Details for d1fpub_

PDB Entry: 1fpu (more details), 2.4 Å

PDB Description: crystal structure of abl kinase domain in complex with a small molecule inhibitor
PDB Compounds: (B:)

SCOP Domain Sequences for d1fpub_:

Sequence, based on SEQRES records: (download)

>d1fpub_ d.144.1.2 (B:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus)}
mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik
wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc
pekvyelmracwqwnpsdrpsfaeihqafetmfqe

Sequence, based on observed residues (ATOM records): (download)

>d1fpub_ d.144.1.2 (B:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus)}
mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
tqissameylekknfihrdlaarnclvgenhlvkvadfglsrtytahagakfpikwtape
slaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvy
elmracwqwnpsdrpsfaeihqafetmfqe

SCOP Domain Coordinates for d1fpub_:

Click to download the PDB-style file with coordinates for d1fpub_.
(The format of our PDB-style files is described here.)

Timeline for d1fpub_: