SCOP 1.73: Domain d1fpua_: 1fpu A:

Lineage for d1fpua_ (1fpu A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Abelsone tyrosine kinase (abl) [56166] (1 species)
   PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase

7. Species Mouse (Mus musculus) [TaxId:10090] [56167] (8 PDB entries)

8. Domain d1fpua_: 1fpu A: [41706]

Details for d1fpua_

PDB Entry: 1fpu, 2.4 Å

PDB Description: crystal structure of abl kinase domain in complex with a small molecule inhibitor

PDB Compounds: (A:) proto-oncogene tyrosine-protein kinase abl

SCOP Domain Sequences for d1fpua_:

Sequence; same for both SEQRES and ATOM records:

>d1fpua_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik
wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc
pekvyelmracwqwnpsdrpsfaeihqafetmfqe

Timeline for d1fpua_:

• d1fpua_ first appeared (with stable ids) in SCOP 1.55
  
• d1fpua_ appears in SCOP 1.71
  
• d1fpua_ appears in SCOP 1.75
  
• d1fpua_ appears in the current release, SCOPe 2.08, called d1fpua1